PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Ote100118750131
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Ocimeae; Ocimum
Family G2-like
Protein Properties Length: 444aa    MW: 49121 Da    PI: 5.0315
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Ote100118750131genomeOteDB-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like105.33.6e-33231285155
                       G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                                   k+r+rWtpeLHe Fveav++LGG e+AtPk +l+lm+v+gLt++hvkSHLQkYR+
  Ote100118750131|100118750131 231 KARMRWTPELHEVFVEAVNKLGGGERATPKGVLKLMNVEGLTIYHVKSHLQKYRT 285
                                   68****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129412.612228288IPR017930Myb domain
SuperFamilySSF466892.51E-18229286IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.605.5E-31230288IPR009057Homeodomain-like
TIGRFAMsTIGR015573.4E-25231285IPR006447Myb domain, plants
PfamPF002498.1E-11233284IPR001005SANT/Myb domain
PfamPF143796.0E-22318363IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 444 aa     Download sequence    Send to blast
MAPALFKRKS SETCSNDVDA SGALSISLHI LPTLSEEKFA KLPDSPQVSL AQELTTNLMS  60
SCPSALSTDN NSPTRSLFSP ASVSPDLSRL RNLPSLSETL IGKGSSKSSS LLASRASQLG  120
KKTKYTDALD TPLQTNREEK CRDVVLSEDD TKRTDWREWA DQLVTDDVSL DLDLSDLLVD  180
VSVPDLDAKL LELPPDANIS QPQIHQHRLP PVLTEQTLPV ATSPCASPVT KARMRWTPEL  240
HEVFVEAVNK LGGGERATPK GVLKLMNVEG LTIYHVKSHL QKYRTARHKP ESSEGTPEKK  300
PKNVAEMASL DLKTAIGITE ALRLQMEVQK QLHEQLEIQR NLQVRIEEQG KHLQMMFEQQ  360
RKMEEEKLKP SSDENRPSPE PETQPPISKS EAEPSNDDHR SSTKETPTHK QADEKDASLE  420
NNTCEDHESN VDETGDSGLS SPPL
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011102186.11e-171PREDICTED: protein PHR1-LIKE 1-like isoform X2
TrEMBLA0A068U7Z01e-113A0A068U7Z0_COFCA; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA45822139